Skip to content
  • Categories
  • Recent
  • Users
Skins
  • Light
  • Brite
  • Cerulean
  • Cosmo
  • Flatly
  • Journal
  • Litera
  • Lumen
  • Lux
  • Materia
  • Minty
  • Morph
  • Pulse
  • Sandstone
  • Simplex
  • Sketchy
  • Spacelab
  • United
  • Yeti
  • Zephyr
  • Dark
  • Cyborg
  • Darkly
  • Quartz
  • Slate
  • Solar
  • Superhero
  • Vapor

  • Default (No Skin)
  • No Skin
Collapse
Free Minds Forum Icon
  1. Home
  2. General Issues / Questions
  3. General Issues / Questions
  4. The Blind Watch-Watchers or Smell the Cheese

The Blind Watch-Watchers or Smell the Cheese

Scheduled Pinned Locked Moved General Issues / Questions
34 Posts 7 Posters 177 Views
  • Oldest to Newest
  • Newest to Oldest
  • Most Votes
Reply
  • Reply as topic
Log in to reply
This topic has been deleted. Only users with topic management privileges can see it.
  • U Offline
    U Offline
    unknownuser
    wrote on last edited by
    #24

    Hi LT,
    I have decided to ignore ROCK studies.

    Because you can't account for fossil record can you Dr. Bmbmm Phd? wink So whether you ignore it or sit on it, thats upto you Doctor -)
    But Scientific research will continue without you -)

    You are not know, as I have debated with Professors about this.

    Appealing to your past professors will not help you here Doctor wink

    Account for the fossil records Dr. Bmbmm Phd or stand aside let others continue their proper empirical scientific work.

    Good luck with your quest with rock-science.

    And good luck with your search for finding coelacanth fish amongst amoebas in the fossil records wink I am sure scientific community will be waiting with baited breath for such a breathrough from yourself!!! -)

    Advance Molecular Biology technique in finding out the truth behind any biological entity?

    Molecular biology? -)

    OK. So tell me Dr.Bmm Phd, how do you account for the beta hymoglobin
    gene in Apes to have 100% match with Humans?

    Regards,

    1 Reply Last reply
    0
    • B Offline
      B Offline
      bmbmm
      wrote on last edited by
      #25

      By the way between 1-100 points what will you give fossil records (technique ) and to the advance Molecular Biology technique in finding out the truth behind any biological entity? Me personally will give the fossil record 1 and Molecualr Biology 100. What about you?

      Just to remind you the top question.

      Hey is that all you got ops ?

      By the way there is also a 100% sequence homology of Octopus rhodopsin kinase and Squid rhodopsin kinase that I cloned! Also you know the hydrogen in the sun is 100% identical to hydrogen on earth.

      beta hymoglobin??? Are you talking about beta globulin or haemoglobin?

      1 Reply Last reply
      0
      • U Offline
        U Offline
        unknownuser
        wrote on last edited by
        #26

        By the way between 1-100 points what will you give fossil records (technique ) and to the advance Molecular Biology technique in finding out the truth behind any biological entity? Me personally will give the fossil record 1 and Molecualr Biology 100. What about you?

        Just to remind you the top question.

        Above question is irrelvant to what we are discussing.

        Hey is that all you got ops ?

        I got nothing. You are the one with Phd wink

        beta hymoglobin??? Are you talking about beta globulin or haemoglobin?

        If you knew this then you would have guessed from my bad spelling.
        beta haemoglobin -)

        So Dr. how do you account for it?

        Regards,

        1 Reply Last reply
        0
        • B Offline
          B Offline
          bmbmm
          wrote on last edited by
          #27

          95.2% identity in 147 residues overlap; Score 746.0; Gap frequency 0.0%

          UserSeq1, 1 MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK
          UserSeq2, 1 MVHLTPEEKNAVTTLWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPK


          UserSeq1, 61 VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG
          UserSeq2, 61 VKAHGKKVLGAFSDGLNHLDNLKGTFAQLSELHCDKLHVDPENFKLLGNVLVCVLAHHFG


          UserSeq1, 121 KEFTPPVQAAYQKVVAGVANALAHKYH
          UserSeq2, 121 KEFTPQVQAAYQKVVAGVANALAHKYH


          --------------------------------------------------------------------------------40.0% identity in 20 residues overlap; Score 40.0; Gap frequency 0.0%

          UserSeq1, 59 PKVKAHGKKVLGAFSDGLAH
          UserSeq2, 125 PQVQAAYQKVVAGVANALAH


          --------------------------------------------------------------------------------35.0% identity in 20 residues overlap; Score 32.0; Gap frequency 0.0%

          UserSeq1, 125 PPVQAAYQKVVAGVANALAH
          UserSeq2, 59 PKVKAHGKKVLGAFSDGLNH


          --------------------------------------------------------------------------------41.2% identity in 17 residues overlap; Score 30.0; Gap frequency 0.0%

          UserSeq1, 18 KVNVDEVGGEALGRLLV
          UserSeq2, 96 KLHVDPENFKLLGNVLV


          --------------------------------------------------------------------------------41.2% identity in 17 residues overlap; Score 29.0; Gap frequency 0.0%

          UserSeq1, 96 KLHVDPENFRLLGNVLV
          UserSeq2, 18 KVNVDEVGGEALGRLLV


          --------------------------------------------------------------------------------33.3% identity in 21 residues overlap; Score 24.0; Gap frequency 0.0%

          UserSeq1, 10 SAVTALWGKVNVDEVGGEALG
          UserSeq2, 50 SSPDAVMGNPKVKAHGKKVLG


          --------------------------------------------------------------------------------38.9% identity in 18 residues overlap; Score 23.0; Gap frequency 0.0%

          UserSeq1, 46 FGDLSTPDAVMGNPKVKA
          UserSeq2, 119 FGKEFTPQVQAAYQKVVA


          --------------------------------------------------------------------------------50.0% identity in 6 residues overlap; Score 21.0; Gap frequency 0.0%

          UserSeq1, 2 VHLTPE
          UserSeq2, 97 LHVDPE


          --------------------------------------------------------------------------------50.0% identity in 6 residues overlap; Score 21.0; Gap frequency 0.0%

          UserSeq1, 97 LHVDPE
          UserSeq2, 2 VHLTPE


          --------------------------------------------------------------------------------35.3% identity in 17 residues overlap; Score 19.0; Gap frequency 0.0%

          UserSeq1, 3 HLTPEEKSAVTALWGKV
          UserSeq2, 118 HFGKEFTPQVQAAYQKV


          --------------------------------------------------------------------------------36.4% identity in 11 residues overlap; Score 19.0; Gap frequency 0.0%

          UserSeq1, 77 AHLDNLKGTFA
          UserSeq2, 63 AHGKKVLGAFS


          --------------------------------------------------------------------------------42.9% identity in 7 residues overlap; Score 18.0; Gap frequency 0.0%

          UserSeq1, 5 TPEEKSA
          UserSeq2, 124 TPQVQAA


          --------------------------------------------------------------------------------60.0% identity in 5 residues overlap; Score 18.0; Gap frequency 0.0%

          UserSeq1, 91 ELHCD
          UserSeq2, 96 KLHVD


          --------------------------------------------------------------------------------60.0% identity in 5 residues overlap; Score 18.0; Gap frequency 0.0%

          UserSeq1, 96 KLHVD
          UserSeq2, 91 ELHCD


          --------------------------------------------------------------------------------33.3% identity in 18 residues overlap; Score 18.0; Gap frequency 0.0%

          UserSeq1, 119 FGKEFTPPVQAAYQKVVA
          UserSeq2, 46 FGDLSSPDAVMGNPKVKA


          --------------------------------------------------------------------------------60.0% identity in 5 residues overlap; Score 18.0; Gap frequency 0.0%

          UserSeq1, 142 LAHKY
          UserSeq2, 115 LAHHF


          --------------------------------------------------------------------------------35.7% identity in 14 residues overlap; Score 18.0; Gap frequency 0.0%

          UserSeq1, 57 GNPKVKAHGKKVLG
          UserSeq2, 17 GKVNVDEVGGEALG


          --------------------------------------------------------------------------------41.7% identity in 12 residues overlap; Score 18.0; Gap frequency 0.0%

          UserSeq1, 126 PVQAAYQKVVAG
          UserSeq2, 59 PKVKAHGKKVLG


          --------------------------------------------------------------------------------60.0% identity in 5 residues overlap; Score 18.0; Gap frequency 0.0%

          UserSeq1, 115 LAHHF
          UserSeq2, 142 LAHKY


          --------------------------------------------------------------------------------28.6% identity in 14 residues overlap; Score 17.0; Gap frequency 0.0%

          UserSeq1, 79 LDNLKGTFATLSEL
          UserSeq2, 76 LNHLDNLKGTFAQL


          Here you go holytree! Top sequence is Human and Bottom sequence is Ape. Buy the way where did you get 100% similarity? Now convince me how good the stone-record is. And please give it a score between 1-100.

          1 Reply Last reply
          0
          • B Offline
            B Offline
            bmbmm
            wrote on last edited by
            #28

            Hi Tree,

            The squid rhodopsin kinase that I cloned has 100% sequency homology with the octopus rhodopsin kinase. The take home message for you today is we cannot say one is evolved from the other with this data or the stone data lol lol . What we can see here is God found it appropriate to use the same peace of information (DNA) for both species wink

            1 Reply Last reply
            0
            • U Offline
              U Offline
              unknownuser
              wrote on last edited by
              #29

              Here you go holytree! Top sequence is Human and Bottom sequence is Ape. Buy the way where did you get 100% similarity? Now convince me how good the stone-record is. And please give it a score between 1-100.

              Sorry Doctor I am not a biochemist like yourself. So gene sequence post does nothing for me. There is a 100% match of DNA sequences in the pseudogene region of beta-globin between apes and humans - how do you account for that Doctor?

              Regards,

              1 Reply Last reply
              0
              • B Offline
                B Offline
                bmbmm
                wrote on last edited by
                #30

                No more comment.

                1 Reply Last reply
                0
                • U Offline
                  U Offline
                  unknownuser
                  wrote on last edited by
                  #31

                  No more comment.

                  Why my Good Doctor? Has the 100% match of DNA sequences in the pseudogene region of beta-globin between apes and humans - made a monkey out of you? wink -)

                  How do you account for it?

                  Regards,

                  1 Reply Last reply
                  0
                  • B Offline
                    B Offline
                    bmbmm
                    wrote on last edited by
                    #32

                    Oh ya I am a monkey now, since you know better about science. I think I might need to do another PhD. Hence, I wil reply when I got my second doctorate. You can have my future Nobel prise for free roll

                    1 Reply Last reply
                    0
                    • S Offline
                      S Offline
                      sawtooth
                      wrote on last edited by
                      #33

                      The style of that article sounds more than familier. I do believe I may have come across your work in college. very interesting but hard to finish in one sittling in front of a computer screen.

                      1 Reply Last reply
                      0
                      • U Offline
                        U Offline
                        unknownuser
                        wrote on last edited by
                        #34

                        Oh ya I am a monkey now, since you know better about science.

                        Dear Doctor I think you missed the joke in my comments. The 100% match between apes and human suggests that we have shared same ancestor in the past. This indeed does make a "monkey" out of us wink -)

                        Molecular studies shows that all life forms on Earth share a common ancestor. Even the leading creation scientist Dr Micheal Behe (his a biochemist) agrees with this view.

                        Regards,

                        1 Reply Last reply
                        0
                        Reply
                        • Reply as topic
                        Log in to reply
                        • Oldest to Newest
                        • Newest to Oldest
                        • Most Votes


                        • Login

                        • Don't have an account? Register

                        • Login or register to search.
                        • First post
                          Last post
                        0
                        • Categories
                        • Recent
                        • Users